<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01377

Description F-box-like/WD repeat-containing protein TBL1X (Fragment)
SequenceSGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASARHSATTALLATTGQFEGATTTAVSQQNTPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNSGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASGSDDMTLKIWSMKQDTCVHDLQAHSKEIYTIKWSPTGPGTSNPNSKHHVASASFDSTVRLWDVDRGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGTLVHSYRGTGGIFEVCWNARGDKVGASASDGSV
Length503
PositionTail
OrganismAptenodytes forsteri (Emperor penguin)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Sphenisciformes> Spheniscidae> Aptenodytes.
Aromaticity0.07
Grand average of hydropathy-0.373
Instability index33.91
Isoelectric point5.67
Molecular weight54365.66
Publications

Function

Annotated function
ECO:0000256	
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats
>MDP01377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     147.16|      15|      17|     229|     243|       1
---------------------------------------------------------------------------
  173-  187 (28.02/14.19)	WNPVSDLL.ASGSGDS
  229-  243 (28.57/14.60)	WNSDGTLL.ATGSYDG
  270-  284 (21.23/ 9.07)	WNKKGNYI.LSAGVDK
  353-  367 (29.25/15.12)	WDPSGMLL.ASGSDDM
  404-  418 (20.33/ 8.39)	NPNSKHHV.ASASFDS
  487-  501 (19.75/ 7.95)	WNARGDKVgASAS.DG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     120.13|      25|      80|     377|     401|       2
---------------------------------------------------------------------------
  377-  401 (48.33/24.53)	DTCVHDLQAHSKEIYTIKWSPTGPG
  428-  450 (34.56/15.92)	GVCIHTLTKHQEPVYSVAFSPDG..
  459-  480 (37.24/17.59)	DKCVHIWNTQSG...TLVHSYRGTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.69|      20|      20|     114|     133|       5
---------------------------------------------------------------------------
  114-  133 (32.58/20.51)	AVSQQNTPKNGEATVNGEEN
  137-  156 (35.11/22.64)	AINNHSKPMEIDGDVEIPPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.91|      27|     117|     192|     219|       8
---------------------------------------------------------------------------
  192-  219 (46.48/31.52)	WNLNENSNSGS.........................................TQLVLRHCiREGGHDVP
  248-  311 (19.27/ 7.31)	W..TEDGNLAStlgqhkgpifalkwnkkgnyilsagvdkttiiwdahtgeakQQFPF.H..SAPALDVD
  312-  337 (50.16/29.81)	WQNNTTFASCS.........................................TDMCIHVC..RLGCDRP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01377 with Med16 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) FEGATTTAVSQQNTPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKAT
107
159

Molecular Recognition Features

MoRF SequenceStartStop
1) IYTIKW
390
395