<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01371
| Description |
Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | RELIEILAISRNQKLPQPGEESQILELLIQRDGEFQELMKLAVDQGKIHHEMQLLEKVVEKRDNDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSNDFMLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 229 |
| Position | Middle |
| Organism | Aptenodytes forsteri (Emperor penguin) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Sphenisciformes> Spheniscidae>
Aptenodytes.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.675 |
| Instability index | 56.18 |
| Isoelectric point | 5.06 |
| Molecular weight | 25554.49 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01371
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.26| 26| 32| 9| 40| 1
---------------------------------------------------------------------------
2- 29 (35.05/23.51) ELIEILAISRNQklPQPGEESQILELLI
34- 59 (43.21/34.61) EFQELMKLAVDQ..GKIHHEMQLLEKVV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.73| 21| 33| 60| 81| 2
---------------------------------------------------------------------------
60- 81 (30.71/24.30) EK.RDNDIQQlQKQLKEAEHILA
95- 116 (30.01/18.83) EKaRKGAISS.EEIIKYAHRISA
---------------------------------------------------------------------------
|