| Description | Mediator of RNA polymerase II transcription subunit 18 (Fragment) |
| Sequence | GSVLDQSLESLLHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDKSGMPWHLRYLGQPEIGDKNRHALVRNCVDIATSDNLTDFLVEMGFRMDHEFVAKGHVFRKGIMKIVVYKIFRILMPGNTESIEPLSLSYLVELNVVAPAGQDVVSDDMRNFAEQLKPLVHLEKIDPKRLM |
| Length | 184 |
| Position | Head |
| Organism | Aptenodytes forsteri (Emperor penguin) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Sphenisciformes> Spheniscidae> Aptenodytes. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.164 |
| Instability index | 42.91 |
| Isoelectric point | 6.41 |
| Molecular weight | 21061.29 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP01367
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.33| 12| 25| 141| 152| 1
---------------------------------------------------------------------------
141- 152 (19.95/11.31) LSYLVELNVVAP
169- 180 (21.38/12.49) LKPLVHLEKIDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.47| 11| 25| 68| 78| 2
---------------------------------------------------------------------------
68- 78 (19.01/10.50) EIGDKNRHALV
96- 106 (21.46/12.56) EMGFRMDHEFV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FVLRAR 2) GMPWHLRYLGQPEI | 44 56 | 49 69 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab