Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MATLMLDDDEFKSLEHIVSRLSQLSSSIQSLRIDILKSNPLPHPSSLQASAQIIQRNLQSLLDSISENSDLLNRLAVRPSPNFPGRTQENALGQLLRKKLEPDVEELVAKGREAAVAATPEGLARMQEVWDDALRWVQQRIAQYVAEEAGDVYTKEEREMGVENVRTGLRRDLDEDEEDEDEDEDEGAGGEGEGEGDGDDNNQKKEGREKREKRGPEPETLLWFAARGDFAVPPNVEYERKQDAYRGLQGVSVPP |
Length | 255 |
Position | Head |
Organism | Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / JCM 23072 / IMI 49137) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreales incertae sedis> Acremonium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.875 |
Instability index | 53.09 |
Isoelectric point | 4.51 |
Molecular weight | 28562.10 |
Publications | PubMed=25291769 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01339 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 106.26| 38| 44| 14| 56| 1 --------------------------------------------------------------------------- 14- 56 (52.82/36.08) LEHIVSRLSQLSSSIQslRidiLKSNPLPH.PSSLQASA..QIIQR 58- 98 (53.44/25.82) LQSLLDSISENSDLLN..R...LAVRPSPNfPGRTQENAlgQLLRK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.99| 21| 44| 112| 132| 2 --------------------------------------------------------------------------- 112- 132 (37.11/21.96) REAAVAATPEGLAR.MQEVWDD 158- 179 (31.87/17.98) REMGVENVRTGLRRdLDEDEED --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.07| 10| 18| 225| 234| 3 --------------------------------------------------------------------------- 225- 234 (20.20/11.61) AARG..DFAVPP 244- 255 (15.87/ 7.88) AYRGlqGVSVPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LRIDILK 2) NQKKEGREKREKRGPEPETLLWFAARGDFAVPPNVEYERKQDAYRGLQGVSVP | 31 202 | 37 254 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab