<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01334
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYELFLTALVEDADFKAACSVLSGLCGMAPWESVTRVLYFQGPPKPSGISNHSSLEKPFRKDTAYLLKELHQSLSRQSFIIQARYEILKDRDMGPTAAPADLDSTPGMLRWTDFPDPPHGRPNITQRKKIEVWEQKKIPTLLSDNSYTFKTENLEEIYRFYRDDIEYCLFRQYFVRPIDDYMPLEHRNTQPSPPHSTLPAWESLVPVDSQDRWILMVKAHVVQDNKPDEIRKAQDQLLSIRGELDGVFDFRAIDRKVHDTRVAQQQQGVQVLPQKVTLGKV |
Length | 281 |
Position | Head |
Organism | Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / JCM 23072 / IMI 49137) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreales incertae sedis> Acremonium.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.553 |
Instability index | 48.44 |
Isoelectric point | 6.19 |
Molecular weight | 32490.63 |
Publications | PubMed=25291769
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01334
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.48| 19| 74| 103| 122| 1
---------------------------------------------------------------------------
103- 122 (37.41/26.33) DSTPGMLRWTDfPDPPHGR.P
180- 199 (36.07/20.29) DYMPLEHRNTQ.PSPPHSTlP
---------------------------------------------------------------------------
|