<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01331
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDTYIDGRFERLEKALANLIDSVNKYHPSTVHAKELEAADEELTKGLEQIQAHQVNYLRVQQLRKSSAALDTQIKDTLTSLASTRRDITNTRTTTFPAGPNYPVAYDELLSYARRISKTTMPPAGTLKPPSGTSATTPEIQTPADMATPSASAAPTPSQPLSPAVNGASTPLPTQQAVVGATQQSAVTTNTSLPDVVSQYLNPLSGQLFFPWPLEDKIRNGALASNQILAEKGIDPRGYDPAEEEERQRKAEEEQKEREEQEKRELEERERRLREERERQRRERERQQEEWRKASMSGPSPERAPSRSNTGEKKQFQFRSLDDDLDEDDED |
| Length | 331 |
| Position | Middle |
| Organism | Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / JCM 23072 / IMI 49137) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreales incertae sedis> Acremonium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.047 |
| Instability index | 57.75 |
| Isoelectric point | 5.06 |
| Molecular weight | 37218.54 |
| Publications | PubMed=25291769
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01331
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.35| 16| 30| 231| 257| 1
---------------------------------------------------------------------------
230- 250 (21.27/23.09) AEKGIDPRgydpaEEEERQRK
257- 272 (26.07/ 6.09) EREEQEKR.....ELEERERR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.36| 14| 16| 130| 143| 2
---------------------------------------------------------------------------
130- 143 (26.56/13.58) PSGTSATTPEIQ.TP
149- 163 (21.80/ 9.87) PSASAAPTPSQPlSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.22| 21| 25| 81| 103| 3
---------------------------------------------------------------------------
81- 103 (35.34/24.25) LASTRRDItnTRTTTFPAGPNYP
109- 129 (38.88/20.86) LLSYARRI..SKTTMPPAGTLKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.23| 17| 29| 276| 292| 4
---------------------------------------------------------------------------
276- 292 (30.93/16.72) ERERQRRER.ERQQEEWR
302- 319 (25.30/12.46) ERAPSRSNTgEKKQFQFR
---------------------------------------------------------------------------
|