Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDTYIDGRFERLEKALANLIDSVNKYHPSTVHAKELEAADEELTKGLEQIQAHQVNYLRVQQLRKSSAALDTQIKDTLTSLASTRRDITNTRTTTFPAGPNYPVAYDELLSYARRISKTTMPPAGTLKPPSGTSATTPEIQTPADMATPSASAAPTPSQPLSPAVNGASTPLPTQQAVVGATQQSAVTTNTSLPDVVSQYLNPLSGQLFFPWPLEDKIRNGALASNQILAEKGIDPRGYDPAEEEERQRKAEEEQKEREEQEKRELEERERRLREERERQRRERERQQEEWRKASMSGPSPERAPSRSNTGEKKQFQFRSLDDDLDEDDED |
Length | 331 |
Position | Middle |
Organism | Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / JCM 23072 / IMI 49137) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreales incertae sedis> Acremonium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.047 |
Instability index | 57.75 |
Isoelectric point | 5.06 |
Molecular weight | 37218.54 |
Publications | PubMed=25291769 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01331 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.35| 16| 30| 231| 257| 1 --------------------------------------------------------------------------- 230- 250 (21.27/23.09) AEKGIDPRgydpaEEEERQRK 257- 272 (26.07/ 6.09) EREEQEKR.....ELEERERR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.36| 14| 16| 130| 143| 2 --------------------------------------------------------------------------- 130- 143 (26.56/13.58) PSGTSATTPEIQ.TP 149- 163 (21.80/ 9.87) PSASAAPTPSQPlSP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.22| 21| 25| 81| 103| 3 --------------------------------------------------------------------------- 81- 103 (35.34/24.25) LASTRRDItnTRTTTFPAGPNYP 109- 129 (38.88/20.86) LLSYARRI..SKTTMPPAGTLKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.23| 17| 29| 276| 292| 4 --------------------------------------------------------------------------- 276- 292 (30.93/16.72) ERERQRRER.ERQQEEWR 302- 319 (25.30/12.46) ERAPSRSNTgEKKQFQFR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYDELL 2) EEWRKASMS 3) NTGEKKQFQFRSLDDDLDEDDED | 105 289 309 | 110 297 331 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab