<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01306

Description AGAP008496-PA-like protein
SequenceMSGQFPGGYQSPSGHRGNYNSPIIQQQLNQMNVPNQMGMMGFNQNSVMNNQQMQGGPGQGGQDMGMNQNMMQQTHQQQGTQGIQSNPQQVPNQHQQGQNQMVGQNQQHQGPQPSPQMVMQQSGGNVGPGNVMNNPQTQQNQPPPNQPGAGTAVQQQQKAEFNLLSLCRIGQETVQDIVSRFQEVFGILRGIQPPNGTNQGQLSSNDKKAKVQEQFRTIRLLFKRLRLLYDKCNDNCQQGMEYTHVESLIPLKGELERSEPVHTEEYKKALQENRELVAMVQLKNKQLREIIDKIRLTIWEINTMLSMRRC
Length310
PositionHead
OrganismAnopheles sinensis (Mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.04
Grand average of hydropathy-0.965
Instability index47.15
Isoelectric point9.08
Molecular weight34974.03
Publications
PubMed=24438588

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01306
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.63|      20|      23|      38|      59|       1
---------------------------------------------------------------------------
   38-   59 (38.56/12.74)	GMMGfnQNSVMNN...QQMQGGPGQ
  124-  146 (33.07/ 7.06)	GNVG..PGNVMNNpqtQQNQPPPNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     137.80|      26|      29|      65|      93|       2
---------------------------------------------------------------------------
   14-   36 (41.53/13.67)	GHRGNYNSPIIQQ......QLNQMNVPNQ
   65-   93 (47.61/22.35)	GMNQNMMQQTHQQQGTqgiQSNPQQVPNQ
   97-  121 (48.66/17.32)	GQNQ.MVGQNQQHQGP...QPSPQMVMQQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01306 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MSGQFPGGYQSPSGHRGNYNSPIIQQQLNQMNVPNQMGMMGFNQNSVMNNQQMQGGPGQGGQDMGMNQNMMQQTHQQQGTQGIQSNPQQVPNQHQQGQNQMVGQNQQHQGPQPSPQMVMQQSGGNVGPGNVMNNPQTQQNQPPPNQPGAGTAVQQ
1
155

Molecular Recognition Features

MoRF SequenceStartStop
NANANA