<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01293

Description Uncharacterized protein
SequenceMGVQPRPPQRTLSNPSLSVQRPSIPQQQQRSLSTQYLPQSPVRKDSVVDLSADSPDAAQNRHGTTPRRGGSRLRLELSSEAFSNILPITTDSPQSMTPSRTAPLSDAMDPGNMSPALSRASQQDLDNPPMPMPKRRPPAAQAVQTPRKPASSTAPAKRDSRPKPYTIETPSAAPRFVSTHKRSNHNTGRDPFSRGLFSGYADFYPWNGNHHEDEWTTEAIQKGTWDRNTQTESASARLAIFPSLKQKSGLNLLSQIYTGILATRKLRGQITAPSTFKPPPRVTLTDTKREVWLRDLSNPTISLRRLSRTIPHGIRGRTLLDQCLNKNVPTERAVWLAKCVGANEIRAFKRKGVNGAFVMGGELKWVRDWTAFVEQFLDGVVWQFTEADWKNKVIYAIRLATHLYSDHLLDRDHYLEWIVAGLESSTQTRLPMWILIAQIYWADMLRSRKHARRMVASLLSHLDAVHTDLDGDIFIQLSGRLAVLLTSLIQTTPESFVNPNTWFKYRHTLKANLYHDDAALAAFHAVDLRVSRLTVGNTESSPATPQQLVSLLDSILQKSMEGDLPEKCWATSDDKQEAAGTIIRWAASVHRPGLSKVYVAARVIRAWAVYGSDLTHVILGILEDVADNDHARKQLMYRLITELARSGHFSIPYYFQWLIARGGYTNASEIDPDDGPCAMRLLVELPVHCFWDRWKIERANLLRRAGGYSVESEQQDMQNAFRCIQHALGLPIPAGDPISQRKPISARKLGQMLKSSSRALNSHVAAQLRDAVDHQLSGMADFAISLPMFTSVRAIMESTEDFAMFSDILRSCVKASNPEVLASCADTINLNLRIFLALGAAEELFDSLLQRLRMMGPGQTVPARPLLAALSSLAERMPSRVQMAQELLQELIQNDRSNAIDACSPVSDSMMSHMHNRENEVSEEIEKLLTSGNSIDPPTMNRMFRNIVPRLDVGWAKADDSRRVLALLLARLRIFDTQHFDKLMSDWLCHLRSLGTRPELMQLLPLLVSLGCISIDVLMRTANVSPPDSTDASFQNTGRPGSSTYLQELLALLLVELPKSVALTAEETYRFQIQQQSAMSEHSKDLLALIRNALLEYALLRQHQPDTSLILDDPNCQKCILEALRYLVIEDAGAVAEAIAVKSLPADAVRLVQTLVSELLVPGASAGASVSFDEVLKLANERTMPFCQLKLNIELSLAQSSAGAAGEHGPSAFDLFAEAMDRAIEARNIMWTTMLPGLNDDIAQSLRSQACNRFLKLMPSIKSSTFEQDATDSARIQMAQNLLGVIESIVLGQAPQKSAQVFTSALVEKLADLWDMVAAKNGEKPAVQAAALAHWLPVLIRFIALHSAQPEGVPGPTQSGPVASKPKSITIPNFESRARSVLVLCGLMLELETLPACSRGTLAQQVFDLALVLIDPLPEELRLTCAKSILQMPGAPPSLSASSDSRLYYLFSAAQPSSADNLMLAHREKPPTTSGAARALYATGHAPNEKLTPFVLRRWELLHEPTPNVGENDTSLNLRLFEAVKVH
Length1527
PositionKinase
OrganismStachybotrys chartarum IBT 40288
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Stachybotryaceae> Stachybotrys.
Aromaticity0.06
Grand average of hydropathy-0.208
Instability index50.96
Isoelectric point8.15
Molecular weight169008.61
Publications
PubMed=25015739

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP01293
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     180.26|      34|      35|     115|     148|       1
---------------------------------------------------------------------------
    6-   44 (30.19/12.26)	....RPPQRTLSNPSLSV..QRPSIP.QQQQRSlstqylpqspvRK
   80-  114 (40.30/19.11)	EAFSNILPITTDSPQSMTPSRTAPLS.DAM..........dpgnMS
  115-  148 (62.49/34.17)	PALSRASQQDLDNPPMPMPKRRPPAA.QAVQTP...........RK
  149-  182 (47.28/23.85)	PASSTAPAKR.DSRPKPYTIETPSAApRFVSTH...........KR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     197.30|      73|     180|     799|     895|       2
---------------------------------------------------------------------------
  392-  438 (56.63/24.60)	............................KVIYAIRLATHLYsDHLLDRDHYL........EWIVAGLeSSTQTRLPMWILIAQ
  749-  776 (23.82/23.34)	LGQMLKSSSRALNSHVAAQLRDAVDHQL.......................................................
  805-  885 (116.85/99.49)	FSDILRSCVKASNPEVLASCADTINLNLRIFLALGAAEELF.DSLLQRLRMMgpgqtvpaRPLLAAL.SSLAERMPSRVQMAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.06|      20|      34|    1034|    1053|       3
---------------------------------------------------------------------------
 1034- 1053 (34.35/26.43)	FQNTGRPGSSTYLQELLALL
 1071- 1090 (33.72/25.77)	FQIQQQSAMSEHSKDLLALI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.59|      11|      34|    1158|    1168|       4
---------------------------------------------------------------------------
 1158- 1168 (19.25/10.51)	ELLVPGASAGA
 1194- 1204 (18.35/ 9.65)	ELSLAQSSAGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.91|      23|      34|     962|     984|       8
---------------------------------------------------------------------------
  962-  984 (38.35/25.63)	RRVLALLLARLRIFDTQHFDKLM
  997- 1019 (39.57/26.71)	RPELMQLLPLLVSLGCISIDVLM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     252.51|      81|     749|     472|     585|       9
---------------------------------------------------------------------------
  500-  585 (128.56/130.08)	NTWFKYRHTLKANLYHDDAALAAfhavDLRVSRLTVGNTES..SPATPQQLVSLLDSILQKSMeGDLPEKCWATSDDKQEA.AGTIIRW
 1252- 1335 (123.95/67.69)	NRFLKLMPSIKSSTFEQDATDSA....RIQMAQNLLGVIESivLGQAPQKSAQVFTSALVEKL.ADLWDMVAAKNGEKPAVqAAALAHW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.47|      17|      41|     662|     680|      10
---------------------------------------------------------------------------
  662-  680 (30.06/29.13)	GGYTNASEidPDDGPCAMR
  706-  722 (32.41/23.18)	GGYSVESE..QQDMQNAFR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01293 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MGVQPRPPQRTLSNPSLSVQRPSIPQQQQRSLSTQYLPQSPVRKDSVVDLSADSPDAAQNRHGTTPRRGGSRLRLELSSEAFSNILPITTDSPQSMTPSRTAPLSDAMDPGNMSPALSRASQQDLDNPPMPMPKRRPPAAQAVQTPRKPASSTAPAKRDSRPKPYTIETPSAAPRFVSTHKRSNHNTGRDPF
1
192










Molecular Recognition Features






MoRF SequenceStartStop




NANANA