<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01278
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPSQLSPGTTTSSSEQPSTNLSASMTSATTLPTPAHSVNGASFQPDVAMTDDTPNKRKRALEDNGDRSHKKPHLEERKLGIDDLHCDVGVKGVVVENCSLTLLFLFLALPESLPRTSDDLFAMFDLTGLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEGTMSEFLSMVQAPELEWNVHEVKGREVADGLSDATLSALGRAMTMSKGAIPKNVWDMSVLGDLAPSSGDARDVAKPTSSSKPTAPNTPLATTPGVSNRPKQSTSSAHDPTRPRRNIKKRTYGDSSFEGYNETYADDDTGMETGYSTGEGEGGQKRRKKVNSHSSNPLAGIDGF |
| Length | 351 |
| Position | Head |
| Organism | Stachybotrys chlorohalonata (strain IBT 40285) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Stachybotryaceae> Stachybotrys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.714 |
| Instability index | 43.21 |
| Isoelectric point | 6.81 |
| Molecular weight | 37753.62 |
| Publications | PubMed=25015739
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01278
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 135.93| 42| 76| 65| 109| 1
---------------------------------------------------------------------------
65- 109 (66.09/53.64) KRKRALEDNGDRSHKKPHLeeRKLGIDDlHCDVGVK..GVVVENCSL
144- 187 (69.83/45.94) REKPNGEKNALRKTYKGHI..KRLGVAG.HFDVQKKkeGTMSEFLSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 109.65| 31| 35| 224| 254| 2
---------------------------------------------------------------------------
191- 220 (21.59/ 8.11) .....PELEWNVhEVKGrEVADGLS..........DAtlSALGRA
224- 254 (54.11/30.06) SKGAIPKNVWDM.SVLG.DLAPSSG..........DA..RDVAKP
258- 290 (33.95/16.45) SKPTAPNTP..........LATTPGvsnrpkqstsSA..HDPTRP
---------------------------------------------------------------------------
|