Description | Uncharacterized protein |
Sequence | MGDRLTQLQDAVDQLAQQFVACLHFVHMRHDLETLGPNDKIRDVKLEPNQKEVDSLPAADFRAGMEELSRDLVLKEREIELLIMALPGLDNTEKDQERYIKDLEEDLKAAEAQRQEALKEKDQILSQLDALIRSIRRP |
Length | 138 |
Position | Middle |
Organism | Stachybotrys chlorohalonata (strain IBT 40285) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Stachybotryaceae> Stachybotrys. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.636 |
Instability index | 45.63 |
Isoelectric point | 4.78 |
Molecular weight | 15929.93 |
Publications | PubMed=25015739 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP01276 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 73.99| 23| 25| 42| 66| 1 --------------------------------------------------------------------------- 17- 33 (23.81/12.53) ........QQFVACLHFVHMRHDLE 42- 66 (33.35/28.40) RDVKLEpnQKEVDSLPAADFRAGME 70- 85 (16.83/ 7.55) RDLVLK..EREIELLIMA....... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DVKLEPNQKEVDSLPAADFRA 2) EELSRDLVLKEREIELLIMALPGLDNTEKDQERYIKDLEEDLKAAEAQRQEALKEKDQILSQLDALIRSIRRP | 43 66 | 63 138 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab