<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01258

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMLLFKSPQAILQPLCALLDSWKWEEDQGESQPVYDEFGSVLLLVLAFRYKYDLSYQDLGIFNPDSFMCRLLEKGSSSQKLEDLTEKQQQNLGAWITALFIAEGISDESMSSCSPQEFYLLVATLFCQSLSACEAGKLEFETLKGGFEYLLEPFLLPSLVMALSWMGKHIWKSGTDLTTTLKLLATLVKPTSISGEAQEIHRTVLSITARELADELRTAKARHPLRTDIEPILQALEPYQSFQRTGTSSRSELEGWRSSSAPGGMVTGIRNTFSSLVLWSTDPEISMTPPSYTHRQLLAGLKHLGSVRILAGILEELKLQSETGSGDLAIDIAATLICAPMRECFSLEQAAYQSVGGSLKDSLPHRQMLNLRYALNLQRESLSKVIEYEPHRAELIVRLARRVDTLTSIPQIPQGVENIDVGNIMANMDLTGVEEDRQMQIDVAQQAEQQDQQHQNLTATGTDATPGTIDAILDAATAEGVTAPPAGTEVTMAQSDMDASIFDDMLNPTDMGVGNPEFIDLDMEGMF
Length526
PositionTail
OrganismTrichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
Aromaticity0.07
Grand average of hydropathy-0.140
Instability index52.65
Isoelectric point4.56
Molecular weight58041.32
Publications
PubMed=22951933

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364142
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP01258
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.42|      11|      21|     107|     117|       1
---------------------------------------------------------------------------
  107-  117 (21.92/10.94)	ESMSSC..SPQEF
  127-  139 (15.50/ 6.15)	QSLSACeaGKLEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.46|      17|      25|     454|     478|       2
---------------------------------------------------------------------------
  456-  474 (25.34/33.93)	LTA..TGTDATPGTIDaiLDA
  480-  498 (25.12/ 6.42)	VTAppAGTEVTMAQSD..MDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.01|      11|      21|     339|     349|       3
---------------------------------------------------------------------------
  339-  349 (21.02/13.01)	PMRECFSLEQA
  363-  373 (20.99/12.98)	PHRQMLNLRYA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.09|      14|      21|     405|     420|       4
---------------------------------------------------------------------------
  405-  420 (20.55/19.06)	LTSIPQIPQGveNIDV
  429-  442 (24.54/15.48)	LTGVEEDRQM..QIDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.55|      16|      28|      25|      42|       6
---------------------------------------------------------------------------
   25-   42 (24.24/21.85)	EDQGESQPvyDEFGSVLL
   56-   71 (31.32/20.26)	QDLGIFNP..DSFMCRLL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01258 with Med5 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EDRQMQIDVAQQAEQQDQQHQNLTATGTDATPGTIDAILDAATAEGVTAPPAGTEVTMAQSDMDASIFDDMLNPTDMGVGNPEFID
434
519










Molecular Recognition Features






MoRF SequenceStartStop




NANANA