<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01256

Description Uncharacterized protein
SequenceMDASANHSAADASLHEQWNKAVFPLLCEIMVRHSSLARDECVKWVTEKFPTGLRLLTQTLDSLLGVEPGNGNLDILPLANGDDAGDANLHADPHRASPSAQSVQQQASDTIHRIDDFSLPFCLIKLQLLLVETDAAGKENVLDPIFSAAETDVKKGLSQWVEVITVLDDEGRRQLQQKAENKLLSLFITSASSSSTGNSDDGPAPHELGLVYLRIIEELASKTPNENVSSTTGSALLERMNLLLQRIAFLSKVKSTDSNSTIIAQRNEGGMIGIWIYILLRLVALYRSFFNVERASKTDLSDQTRLLLSICYMAFTPAFMQVLSHTTNLPPTPTGKYAHLQRTVPGNWNSIRIYTIDVATILVDTLPDEARIQCARFLRDRSPLFQQQQDSRLLYLFGPMPDPQASPISPSTGTTTSSAPPPGSSPLNTQSLAAQGSSAQPPQPPHPTNPSIPTVEETTSPIQNFRFQQGNRVIGPCPPRTWEMIEESAPVVGVNDTALNLSYFGARLVRAGLK
Length514
PositionKinase
OrganismTrichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Trichophyton.
Aromaticity0.06
Grand average of hydropathy-0.220
Instability index44.21
Isoelectric point5.45
Molecular weight56167.93
Publications
PubMed=22951933

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01256
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.80|      21|      25|     180|     200|       1
---------------------------------------------------------------------------
  180-  200 (33.47/19.18)	ENKLLSLFITSASSSSTGNSD
  207-  227 (34.33/19.83)	ELGLVYLRIIEELASKTPNEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.03|      15|      27|     278|     292|       7
---------------------------------------------------------------------------
  278-  292 (24.84/15.08)	ILLRL..VALYRSFFNV
  306-  322 (21.20/11.95)	LLLSIcyMAFTPAFMQV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.52|      12|      32|     435|     446|      10
---------------------------------------------------------------------------
  435-  446 (25.13/14.42)	QGSSAQPPQPPH
  469-  480 (25.39/14.65)	QGNRVIGPCPPR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01256 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YLFGPMPDPQASPISPSTGTTTSSAPPPGSSPLNTQSLAAQGSSAQPPQPPHPTNPSIPTVEETTSPIQNFRFQQGNRV
395
473










Molecular Recognition Features






MoRF SequenceStartStop




NANANA