<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01238

Description BnaCnng35580D protein
SequenceMMKSGEKREEIITLAIDRDKESQNALKWTVDNLVSKGQTLTLLHVKLKQFPSLPYSGSYPNRSGDDGTELFLPFRCYCARKDVLCQDVIVEDISAAKGILDYVQKNAIETLVLGASKMNLLRFKAADVSNTVMKRAPSFCTVYAISKGKISSMKSATSSLPNSTMRSNMNVERRQHTMHRMHDEIQIEIKSPFMRRGYEGRYQPSMTDSDISFVSSGRPSVDLMFPSFGDHVDVPRLSVNSDYEENRISFATSSSSSDKQSIDLGSSYTAFSSSSGRPSCSLSTQDEIEAEMRRLKMELKHTMDMYNSACKEAISAKKAAIELYKWKADKERKLEEVRLSKEEAMAMAESEKEKSRAAIETAVAAHRIAELEAQKTKHIIEENNKSVVKTTDLRYRKYIIEEIEEATEDFSPSRKIGEGGYGPVYKGALDFTQVAIKVLRPDAAQGRSQFQQEVEVLTSMRHTNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNSPALSWQLRFRIAAEIATGLHFLHQMKPEPLVHRDLKPGNILLDQHYVSKISDVGLARLVPPSVADTATQYRMTSTAGTFCYIDPEYQKTGMLGTKSDIYSFGIMLLQILTAKPPMGLTYHVERAIENRTFAEMLDPSVADWPLEEALVAAKLAVQCAELRRKDRPDLGNVVLPELNRLRTLAEESMLPTNIGGSKRPTRNRNNNIYIQSPLSTTSLHEIMSGPQLHYASDTPSIHKKIAS
Length738
PositionTail
OrganismBrassica napus (Rape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.07
Grand average of hydropathy-0.423
Instability index53.98
Isoelectric point7.88
Molecular weight82754.60
Publications
PubMed=25146293

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01238
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      62.60|      14|      15|     248|     261|       1
---------------------------------------------------------------------------
  211-  220 (19.26/ 8.30)	I..SFV....SSGRPS
  248-  261 (23.27/11.40)	I..SFATSSSSSDKQS
  264-  279 (20.06/ 8.91)	LgsSYTAFSSSSGRPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.85|      14|      17|     377|     393|       2
---------------------------------------------------------------------------
  377-  393 (19.41/18.43)	KHIIEENNKSvvkTTDL
  397-  410 (24.44/14.46)	KYIIEEIEEA...TEDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.76|      15|      15|     165|     179|       3
---------------------------------------------------------------------------
  165-  179 (27.32/21.42)	MRSNMNVERRQHTMH
  181-  195 (26.44/20.48)	MHDEIQIEIKSPFMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.93|      29|      73|     534|     563|       4
---------------------------------------------------------------------------
  534-  563 (46.09/38.59)	KPgNILLDQHYVSKISDVGLARLVPPSVAD
  610-  638 (52.84/38.70)	KP.PMGLTYHVERAIENRTFAEMLDPSVAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      14|      15|     331|     344|       5
---------------------------------------------------------------------------
  331-  344 (21.19/14.54)	ERKLEEVRLSKEEA
  349-  362 (21.11/14.46)	ESEKEKSRAAIETA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.42|      36|     345|      95|     143|       6
---------------------------------------------------------------------------
   95-  143 (49.35/62.61)	AAKGILDYVQKnaIETLV.LGASKMNLLrfkaadvsntvMKRAPSF.CTVY
  443-  480 (57.07/39.57)	AAQGRSQFQQE..VEVLTsMRHTNMVLL...........LGACPEYgCLVY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01238 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA