<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01238

Description BnaCnng35580D protein
SequenceMMKSGEKREEIITLAIDRDKESQNALKWTVDNLVSKGQTLTLLHVKLKQFPSLPYSGSYPNRSGDDGTELFLPFRCYCARKDVLCQDVIVEDISAAKGILDYVQKNAIETLVLGASKMNLLRFKAADVSNTVMKRAPSFCTVYAISKGKISSMKSATSSLPNSTMRSNMNVERRQHTMHRMHDEIQIEIKSPFMRRGYEGRYQPSMTDSDISFVSSGRPSVDLMFPSFGDHVDVPRLSVNSDYEENRISFATSSSSSDKQSIDLGSSYTAFSSSSGRPSCSLSTQDEIEAEMRRLKMELKHTMDMYNSACKEAISAKKAAIELYKWKADKERKLEEVRLSKEEAMAMAESEKEKSRAAIETAVAAHRIAELEAQKTKHIIEENNKSVVKTTDLRYRKYIIEEIEEATEDFSPSRKIGEGGYGPVYKGALDFTQVAIKVLRPDAAQGRSQFQQEVEVLTSMRHTNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNSPALSWQLRFRIAAEIATGLHFLHQMKPEPLVHRDLKPGNILLDQHYVSKISDVGLARLVPPSVADTATQYRMTSTAGTFCYIDPEYQKTGMLGTKSDIYSFGIMLLQILTAKPPMGLTYHVERAIENRTFAEMLDPSVADWPLEEALVAAKLAVQCAELRRKDRPDLGNVVLPELNRLRTLAEESMLPTNIGGSKRPTRNRNNNIYIQSPLSTTSLHEIMSGPQLHYASDTPSIHKKIAS
Length738
PositionTail
OrganismBrassica napus (Rape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.07
Grand average of hydropathy-0.423
Instability index53.98
Isoelectric point7.88
Molecular weight82754.60
Publications
PubMed=25146293

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01238
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      62.60|      14|      15|     248|     261|       1
---------------------------------------------------------------------------
  211-  220 (19.26/ 8.30)	I..SFV....SSGRPS
  248-  261 (23.27/11.40)	I..SFATSSSSSDKQS
  264-  279 (20.06/ 8.91)	LgsSYTAFSSSSGRPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.85|      14|      17|     377|     393|       2
---------------------------------------------------------------------------
  377-  393 (19.41/18.43)	KHIIEENNKSvvkTTDL
  397-  410 (24.44/14.46)	KYIIEEIEEA...TEDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.76|      15|      15|     165|     179|       3
---------------------------------------------------------------------------
  165-  179 (27.32/21.42)	MRSNMNVERRQHTMH
  181-  195 (26.44/20.48)	MHDEIQIEIKSPFMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.93|      29|      73|     534|     563|       4
---------------------------------------------------------------------------
  534-  563 (46.09/38.59)	KPgNILLDQHYVSKISDVGLARLVPPSVAD
  610-  638 (52.84/38.70)	KP.PMGLTYHVERAIENRTFAEMLDPSVAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      14|      15|     331|     344|       5
---------------------------------------------------------------------------
  331-  344 (21.19/14.54)	ERKLEEVRLSKEEA
  349-  362 (21.11/14.46)	ESEKEKSRAAIETA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.42|      36|     345|      95|     143|       6
---------------------------------------------------------------------------
   95-  143 (49.35/62.61)	AAKGILDYVQKnaIETLV.LGASKMNLLrfkaadvsntvMKRAPSF.CTVY
  443-  480 (57.07/39.57)	AAQGRSQFQQE..VEVLTsMRHTNMVLL...........LGACPEYgCLVY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01238 with Med32 domain of Kingdom Viridiplantae
Unable to open file!