<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01226

Description BnaC02g44910D protein
SequenceMVCVFDSEMSQDSSLVCRDPEGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKPADVPGTITKTAPDFCTVYVIFKGKISTMRSASRSAPNISPLRTPIQPPSLRPPQPVPSTATNMRADRRSFETQQRRSTEDRRSIEDQQRRSMEDQQRRSMEDLQRRSMEDQSDSFRSPFTRRGNGRSYGELSVPESDISFVSSGRASIDRIFPNLYDNSDPNRTPPRLSNYSDMDYGPSLESSNYGRRSLDVSSPTDLSNGSFESERFSSASAMDDVESEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRWKLEEERKLEEARLAEEAALAIAEKEKAKSKAAMEAAEAAQRIAELESKKRVNAEMKALKESDEKTKALNALANSDVRYRKYSIEEIEHATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKILRADAAQGMSQFQQEIEVLSCIRHPNMVLLLGACPEGGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAEIGTGLLFLHQAKPEPLVHRDLKPGNILLDRNFVSKISDVGLARLVPPSVADTVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDIYSLGIIFLQLITAKPPMGLTHYAERALEKGTLSDLLDPAVPDWPVEDTAEFAKLALQCAELRRKDRPDLAKVILPVLNRLRTLADESTQSLLVINSPGPSPNSSQTSVKLEQMSGASISVPQ
Length740
PositionTail
OrganismBrassica napus (Rape)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.07
Grand average of hydropathy-0.488
Instability index62.72
Isoelectric point5.79
Molecular weight82708.89
Publications
PubMed=25146293

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      93.32|      21|      21|     151|     171|       1
---------------------------------------------------------------------------
  151-  164 (19.62/ 8.88)	........RRSFETQQRRSTED
  165-  186 (36.41/23.00)	RRSIEDQqRRSMEDQQRRSMED
  189-  209 (37.29/23.74)	RRSMEDQ.SDSFRSPFTRRGNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     145.40|      49|      49|     325|     373|       2
---------------------------------------------------------------------------
  291-  322 (33.90/16.74)	RFSSASAMD..................dveSEMRRLKLELKQTMEMYSTA.........................
  325-  364 (53.09/30.01)	..................EALTAKQKA...TELQRWKLEEERKLEEARLA..............EEAALAIAEKE
  365-  436 (58.41/33.69)	KAKSKAAMEaaeaaqriaELESKKRVN...AEMKALKESDEKTKALNALAnsdvryrkysieeiEHATEFFAEKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.01|      27|      49|     487|     515|       3
---------------------------------------------------------------------------
  487-  515 (44.53/30.94)	MVLLLGACPEGgcLVYEFMANGS.LEDRLF
  539-  566 (45.48/24.67)	LLFLHQAKPEP..LVHRDLKPGNiLLDRNF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.17|      19|      22|     247|     266|       4
---------------------------------------------------------------------------
  247-  266 (31.24/21.00)	RTPPRLSNYSDMDYGpSLES
  271-  289 (32.93/17.15)	RRSLDVSSPTDLSNG.SFES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.02|      14|      51|      84|      97|       5
---------------------------------------------------------------------------
   84-   97 (26.17/14.99)	PADVPGTITKTAPD
  137-  150 (26.85/15.57)	PQPVPSTATNMRAD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01226 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ASRSAPNISPLRTPIQPPSLRPPQPVPSTATNMRADRRSFETQQRRSTEDRRSIEDQQRRSMEDQQRRSMEDLQRRSMEDQSDSFRSPFTRRGNGRSYGELSVPESDISF
2) RIFPNLYDNSDPNRTPPRLSNYSDMDYGPSLESSNYGRRSLDVSSPTDLSNGSFESERFSSAS
115
234
224
296










Molecular Recognition Features






MoRF SequenceStartStop




NANANA