<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01217
| Description |
BnaCnng24250D protein |
| Sequence | MQSLQQSLAASHQSEPDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASNPRHNDAPLQLFLKEDASMRQHLQDLRSIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHIDDGLKTEPGSKKHRASHSLLEHGGEEPVEYKTLPDIQSRLEKLVPNVKVSSYGRLSWLKRASSLPESGSDDDPSEESKPIFQSSSKMRSGLHDEVVDKVAVIELSFPSVFRAVVSLNPAGSVDPDAVAFFSLDEGGSYLHARGFSVHHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESLYSKPCSKCGKLLAMDKKSSLILPPLHRAYQELPLAANLSVCEAYHAGCSSDGS |
| Length | 396 |
| Position | Tail |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.301 |
| Instability index | 51.70 |
| Isoelectric point | 7.27 |
| Molecular weight | 43429.80 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01217
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.11| 19| 43| 167| 186| 1
---------------------------------------------------------------------------
167- 186 (30.45/24.55) SKKHRAShSLLEHGG.EEPVE
213- 232 (31.65/19.66) SWLKRAS.SLPESGSdDDPSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.59| 16| 42| 4| 19| 2
---------------------------------------------------------------------------
4- 19 (28.19/15.95) LQQSLAASHQSEPDAP
48- 63 (29.40/16.90) LEAMFVASNPRHNDAP
---------------------------------------------------------------------------
|