<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01212
| Description |
BnaA05g36640D protein |
| Sequence | MDASLLSADTFNGNAGEQIAPPLQPPGTDMTGICFRDQLWINSYPLDRNYVFDYFALSPFYDITCSNEILRRRSVHPLDHSQLSKMTGLEYVISDATEPNFFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCTVFAARVGRAVYNISNAFSVAASKLETIRQGDAKSQNEPSESKPASETVDLKEVKRVDLILKSLYSKLPPAPPPPPFPEGYVSQEALGEKEEEVGTQGGESQQPQIDPIIDQGPAKRMKF |
| Length | 255 |
| Position | Head |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.465 |
| Instability index | 58.81 |
| Isoelectric point | 5.02 |
| Molecular weight | 28401.74 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP01212
No repeats found
No repeats found
|