<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01211
Description |
BnaA02g30360D protein |
Sequence | MAANFWTSSHYKQLMEQEEVDVVHPLDKERGISVEDFKLIKFHMSNHMIKLAQHIKVRQRVVATAVTYMRRVYTRKSMVEFEPRLVALACMYLASKAEESIVQARNIIFYIRKLYPDEYKYELKDVLGMEMKVLEALNYYLVFHPYRSLSEFLQDAAINDVNMNQITWGIVNDTYKMDLILVHPPYRIALACIYIASVHTEKDITAWFEDLHEDMNLVKNIAMEILDFYENYRSITEEKVNSAFSKLALKP |
Length | 251 |
Position | Kinase |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.145 |
Instability index | 40.48 |
Isoelectric point | 6.15 |
Molecular weight | 29609.07 |
Publications | PubMed=25146293
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP01211
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.68| 22| 99| 83| 104| 1
---------------------------------------------------------------------------
83- 104 (38.51/25.14) PRLVALACMYLASKAEESIVQA
185- 206 (40.17/26.47) PYRIALACIYIASVHTEKDITA
---------------------------------------------------------------------------
|