Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSSPKEMDDTSEPPSPPKNTYKDPDGGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVAPPPPASLPPAPPAPAAPSPMQYDNMLPKNEPRNMVSAGIDRRKRKYVLLSSSS |
Length | 192 |
Position | Middle |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.788 |
Instability index | 71.75 |
Isoelectric point | 9.22 |
Molecular weight | 22544.60 |
Publications | PubMed=25146293 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP01201 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.11| 20| 27| 31| 50| 1 --------------------------------------------------------------------------- 31- 50 (36.63/19.64) FLLELEFVQCLANPTYIHYL 61- 80 (38.48/20.94) FIGYLKYLQYWQRPEYIKFI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.26| 19| 26| 86| 104| 3 --------------------------------------------------------------------------- 86- 104 (33.78/17.74) LYFLELLQNPNFRTAMAHP 115- 133 (36.48/19.67) FYYWKNYRNNRLKHILPRP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) YDNMLPKNEPRNMVSAGIDRRKRKYVLLSS 2) YYWKNYR | 161 116 | 190 122 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab