<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01197
Description |
BnaA06g33860D protein |
Sequence | MERATTQQQQAPPVAEELNLDYVKRQTQSLQKAISRILEDFEAYSQTNTTPKWKDILGRYKMINLDLFILVEEVKQVSKALVVFPKNVNAENASILPVMLASKLLPEMETDNNVKIDHLLQDVQSLPVPMQIETLKERIGKIAEVCGNAGKVLADARKAYGLAPQRGGPSMLPTTMDKAQAEKIREQENMLRAAVNEGEGIRLPPDQRQITTELPPHMVDALFVNDAVFNSSGMMQTQQSQSQQPEEQQQHQQQGGEY |
Length | 258 |
Position | Head |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.556 |
Instability index | 54.83 |
Isoelectric point | 5.17 |
Molecular weight | 28964.68 |
Publications | PubMed=25146293
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01197
No repeats found
No repeats found
|