<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01196
| Description |
BnaC06g01900D protein |
| Sequence | MFCFFEIGFFNNKWKFKLKKKVLHFYVCDVQKMERDGGPIDKHAQGKQMVHAIKRKPICLGYSSSYCLCSCRYKKIKALDPEAKFKNAKRRFQEAYQQHEKAKRRRTIQVLEMIPNQRKAQRPLLKRPVRR |
| Length | 131 |
| Position | Unknown |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.819 |
| Instability index | 54.80 |
| Isoelectric point | 10.28 |
| Molecular weight | 15781.63 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.69| 11| 15| 94| 104| 2
---------------------------------------------------------------------------
94- 104 (19.06/10.11) EAYQQHEKAKR
112- 122 (19.63/10.57) EMIPNQRKAQR
---------------------------------------------------------------------------
|