<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01193
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSSPEEMDDTSEPPSPPKNTYNDPDGGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVAPQPPASLPPAPSAPAAPSPAPSPMQYSNMLPKNETRNMVSAGIDRRKRKKGP |
| Length | 191 |
| Position | Middle |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.855 |
| Instability index | 73.69 |
| Isoelectric point | 9.13 |
| Molecular weight | 22326.22 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP01193
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.50| 13| 143| 4| 16| 1
---------------------------------------------------------------------------
4- 16 (25.96/ 9.40) PEEMDDTSEPPSP
150- 162 (25.53/ 9.15) PSAPAAPSPAPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 20| 27| 31| 50| 2
---------------------------------------------------------------------------
31- 50 (36.56/19.45) FLLELEFVQCLANPTYIHYL
61- 80 (39.01/21.12) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.59| 25| 26| 86| 110| 3
---------------------------------------------------------------------------
86- 110 (41.94/24.63) LYFLELLQNPNFRTAMAHPANKELA
115- 139 (46.64/28.21) FYYWKNYRNNRLKHILPRPLPEPVA
---------------------------------------------------------------------------
|