<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01189
| Description |
BnaA07g09420D protein |
| Sequence | MSDEEHHFESSDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVCYSLLTDSGGTKDDLKLPTDDSLSALMKSGFEEGKDVVVSVMSSMGEEQICAVKEVGGGKSCPDIYHHHLAIMDEGRQKDLQLLEEIIDKGLKQKLLQTIASRDKIFEEQKELSDLRKNIETLEKNGVNSLKTMVNLGSEVYMQAEVPDTRHIFMDVGLGFYVEFTRQEALDYIPKREELVKKQLEEVTKVIAQIKGRIKLAHHQIQQILNLPDENPSSHRQPVMEPGQNTSAAGIGGSNGTTTMGYQTNDGTATASEDSKENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQVPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEELEETFPDEVDKYREIRAASAAEAKRVAQSQSVLPNGDAKVKSEL |
| Length | 515 |
| Position | Middle |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.496 |
| Instability index | 42.18 |
| Isoelectric point | 5.61 |
| Molecular weight | 57081.90 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
Binds specifically to cytosolic chaperonin (c-CPN) and
transfers target proteins to it. Binds to nascent polypeptide chain and
promotes folding in an environment in which there are many competing
pathways for nonnative proteins.
ECO:0000256 ARBA:ARBA00003430
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
prefoldin complex GO:0016272 IEA:InterPro
|
| GO - Biological Function | ribosome binding GO:0043022 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
translation elongation factor activity GO:0003746 IBA:GO_Central
unfolded protein binding GO:0051082 IEA:InterPro
|
| GO - Biological Process | positive regulation of translational elongation GO:0045901 IBA:GO_Central
positive regulation of translational termination GO:0045905 IEA:InterPro
protein folding GO:0006457 IEA:InterPro
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01189
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 564.61| 192| 244| 3| 226| 1
---------------------------------------------------------------------------
3- 226 (287.12/273.22) DEEHHFESSDAGASKTYPQQAG..NIRKGGHIVIKgrpcKVVEVSTSKTGKHGHAK.CHFVAIDIFtakKLEDIVPSSHNCDV..PHVN.............RIDYQLID....ISEDGFVCYSLLTDSggTKDDLKLPTDDSLSAlmkSGFEEGKDV........VVSVMSSMGE.EQICAVKevgggkscpdIYHHHLAIMDEGRQKDlQLLEEIIDKGLkqkllqtiaSRDKIFEEQKE.LSDLRKNI.ETLEK
250- 474 (277.48/192.32) DTRHIFMDVGLGFYVEFTRQEAldYIPKREELVKK....QLEEVTKVIAQIKGRIKlAHHQIQQIL...NLPDENPSSHRQPVmePGQNtsaagiggsngttTMGYQTNDgtatASEDSKENLNQVINS..IQKTLGLLHQLHLTV...SSFTPASQLhllqrlnsLVSELNSMTKlSEKCNIQ..........VPMEVLSLIDDGKNPD.EFTRDVINSCV.........ARNQVTKGKTDaFKDLRKHIlEELEE
---------------------------------------------------------------------------
|