<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01178
Description |
BnaA07g00930D protein |
Sequence | MKPSFASAFMKPLLEMLFIRIQLVKADIIPQLQEPVNLIAAITFKAFGTLQRDAPLVQISPNYLIHHFLLLQLRLPLILPLLFRET |
Length | 86 |
Position | Middle |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.638 |
Instability index | 44.28 |
Isoelectric point | 9.82 |
Molecular weight | 9879.91 |
Publications | PubMed=25146293
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01178
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.08| 21| 38| 23| 45| 1
---------------------------------------------------------------------------
23- 45 (29.88/17.58) LVKADIIPQLQEPvnLIAAITFK
64- 84 (36.20/16.43) LIHHFLLLQLRLP..LILPLLFR
---------------------------------------------------------------------------
|