<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01172
Description |
BnaA06g10490D protein (Fragment) |
Sequence | MDNNNLIPSLPKGEPAMDTCDWRAQLPSDSREKIIGKIMETLRKQLPYSGTEEIKELRRIASRFEERIFGCAANPMLTMETTKLQSAASSYSLPLNPGWHQMTIEGPIKAEPAVNTSDWRTCLPPDSLCTVCLSLRNS |
Length | 138 |
Position | Tail |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.475 |
Instability index | 60.90 |
Isoelectric point | 5.86 |
Molecular weight | 15453.58 |
Publications | PubMed=25146293
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01172
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.55| 19| 95| 12| 30| 1
---------------------------------------------------------------------------
12- 30 (40.54/25.35) KGEPAMDTCDWRAQLPSDS
109- 127 (40.01/24.94) KAEPAVNTSDWRTCLPPDS
---------------------------------------------------------------------------
|