Description | BnaC05g12530D protein |
Sequence | MMMKNKAGGAGGGMSGSGEGAGPTAAAAAAALQKQKALLQRVETDITSVVDNFTQIVNVARVSDLPVKNSQEAYMMEMRASKMVQAADSILKLVSELKQTAIFSGFASLNDHVEQRIAEFDQEAEKTNRLLARIGDDASASLKELEAHYYSSAQRLTPDQQKS |
Length | 163 |
Position | Head |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.331 |
Instability index | 35.15 |
Isoelectric point | 5.72 |
Molecular weight | 17452.53 |
Publications | PubMed=25146293 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01159 No repeats found |
MoRF Sequence | Start | Stop |
1) ASLKELEAHYYSSAQRLTPDQQK 2) MMMKNK 3) RLLARIGD | 140 1 129 | 162 6 136 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab