<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01158
Description |
BnaC08g15070D protein |
Sequence | MDNILDSLNKAYEKFVIASAEVLESKESAGGIKASLTDAALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTGGGSNSGQSVGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGGAAAGSVHSSSSAGFDPRYMDSNEPMLLLSSRIGQIGDLGLDLLWRFLHIVVSLFHIVSGIFEAIQSYAISLGLIQKYSSVDIEKLRCLAVVLDIEVARDVAKVVELLQWLKTIGVKQVGLFDSQGLLKKSKDMILEMVPGSTLLQETGEKDISPDRKEGIAIEFISSSDNKEAVVKAANILLKRHLKTSHPEKDEGNNVFTESHLNEALRVVGENVHVPDLMLVYGPVRSHLGFPAWRLRYTEIVHMGSLKYMRYGSLLKAIHKFTGVRQNYGKSFSPLTWI |
Length | 409 |
Position | Tail |
Organism | Brassica napus (Rape) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.021 |
Instability index | 49.46 |
Isoelectric point | 6.11 |
Molecular weight | 44948.11 |
Publications | PubMed=25146293
|
Function
Annotated function |
|
GO - Cellular Component | dehydrodolichyl diphosphate synthase complex GO:1904423 IBA:GO_Central
endoplasmic reticulum membrane GO:0005789 IBA:GO_Central
integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | transferase activity, transferring alkyl or aryl (other than methyl) groups GO:0016765 IEA:InterPro
|
GO - Biological Process | dolichol biosynthetic process GO:0019408 IBA:GO_Central
protein glycosylation GO:0006486 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP01158
No repeats found
|