| Description | BnaA08g25140D protein |
| Sequence | MDNIVDSLNKAYEKFVIASADVLESKESAGGLKASLTDAALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTTTTTGGGSNSGQSVGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGGAAAGSVHSPRFSEDSTQ |
| Length | 148 |
| Position | Tail |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.228 |
| Instability index | 50.66 |
| Isoelectric point | 4.73 |
| Molecular weight | 15657.21 |
| Publications | PubMed=25146293 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP01136 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AAAGSVHSPRFSEDSTQ 2) WLVLELQRG | 132 120 | 148 128 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab