<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01125
| Description |
BnaA09g20250D protein |
| Sequence | MDIISQLQEQVNSIAAITFNAFGTLQRDAPPVQLSPNYPEPPAAAAAATTTTTTTATDGDATAAFPEQPKQLSADLVKAAKQFDALVAALPLSEGGEEAQLKRIAELQVENDLIGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE |
| Length | 150 |
| Position | Middle |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.329 |
| Instability index | 54.57 |
| Isoelectric point | 4.36 |
| Molecular weight | 16004.76 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP01125
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.92| 23| 24| 60| 82| 1
---------------------------------------------------------------------------
38- 55 (20.83/ 7.52) ......YPEPPAAAAAATTTTTTT
60- 82 (36.40/17.76) DA.TAAFPEQPKQLSADLVKAAKQ
84- 106 (23.69/ 9.40) DAlVAALPLSEGGEEAQLKRIAE.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.61| 17| 24| 112| 128| 2
---------------------------------------------------------------------------
112- 128 (26.50/13.50) DLIGQELQKQLEAAEKE
134- 150 (30.11/16.06) ELFGQAADNCLNMKKPE
---------------------------------------------------------------------------
|