<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01123
| Description |
BnaA01g23760D protein |
| Sequence | MFSGLIIIVKSYSYAFNHGLVSCYFIFLSSFFFFWLPLDLVFEDAMDGYQVNPTSAIEIITGLAKTLKGINGSNWHDTFLGIWIAALRLVQRERDPIEGPIPRLDTRLCMSLCIVPLVVATLIEEGESEFVMKKLRDDLITSLQALGEFPGLLAPPQ |
| Length | 157 |
| Position | Tail |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.465 |
| Instability index | 38.44 |
| Isoelectric point | 4.79 |
| Molecular weight | 17619.43 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01123
No repeats found
No repeats found
|