<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01119
| Description |
BnaC09g38220D protein |
| Sequence | MESESAKFGGPRELGGARDLITQYKLLPHHEFFCKRSLPESLSDAHYLHNVVGDTDIRKGEGMQLDQLIPNASHNRDTNARIQPFVLDELKEAFELNDTSPVELPPAEKGALTIASKSKSDSKDRDRKHKKHKDRNKDKDREHKKHKHKHKDRSKDKDKDKDRERKKEKSGHHDKKRKHNGNEDLDDAQRHKKSKHKSSKVDER |
| Length | 204 |
| Position | Head |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.677 |
| Instability index | 38.22 |
| Isoelectric point | 9.52 |
| Molecular weight | 23722.16 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP01119
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.46| 21| 21| 132| 152| 1
---------------------------------------------------------------------------
132- 152 (42.11/13.54) HKDRNKDKDREHKKHKHKHKD
154- 174 (38.35/11.80) SKDKDKDKDRERKKEKSGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.19| 14| 21| 54| 68| 2
---------------------------------------------------------------------------
54- 68 (20.48/22.85) DTDIRKgEGMQLDQL
77- 90 (24.71/20.23) DTNARI.QPFVLDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.19| 12| 15| 175| 187| 3
---------------------------------------------------------------------------
175- 187 (17.20/12.37) KKRKHNGNEdLDD
192- 203 (19.99/ 9.39) KKSKHKSSK.VDE
---------------------------------------------------------------------------
|