<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01118
| Description |
BnaC06g14140D protein |
| Sequence | MLSVTPEISWKLQLYFIGLKREDHDPASAESLRKKIAVMEDKLNTKEELTKKHTRFIQESHIQVKEQIEKQSGGAGISINIKQSLNSK |
| Length | 88 |
| Position | Head |
| Organism | Brassica napus (Rape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.685 |
| Instability index | 62.72 |
| Isoelectric point | 9.26 |
| Molecular weight | 10076.48 |
| Publications | PubMed=25146293
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01118
No repeats found
No repeats found
|