<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01082
| Description |
C/H/G cyclin |
| Sequence | MAANYWDSTQRTHWTFTKDQLDDMRSQQQQENQELYNKYPLPEPRLMNIYIQQQIVKLGRRMNVRQQPLATAQIYVRRFYTKVEMRRTNPYLVMTTAVYVACKVEECPIHIRLVLAEAARQWPELGINDISKIGECEFHLISTMSARMIVHHPYRTLNDLAPGLSMSTEETALSQNIINDHYNTDMPLMYPPHIIAVTAMFLAVVLRPTQSNLQAHAAATSSPAIKSALDSPNKIARLTDWMAASQIDIPAVMAATQEFLSLYEVWENYGERACKEAISRFMKDAQLGK |
| Length | 289 |
| Position | Kinase |
| Organism | Aureobasidium pullulans EXF-150 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.318 |
| Instability index | 61.69 |
| Isoelectric point | 7.09 |
| Molecular weight | 33196.83 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01082
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.04| 22| 22| 29| 50| 1
---------------------------------------------------------------------------
29- 50 (40.21/21.62) QQENQELYNKYPLPEPRL..MNIY
52- 75 (32.83/16.65) QQQIVKLGRRMNVRQQPLatAQIY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.48| 16| 19| 82| 97| 2
---------------------------------------------------------------------------
82- 97 (28.18/21.62) KVEMRRTNPYLVMTTA
103- 118 (27.30/20.74) KVEECPIHIRLVLAEA
---------------------------------------------------------------------------
|