Description | C/H/G cyclin |
Sequence | MAANYWDSTQRTHWTFTKDQLDDMRSQQQQENQELYNKYPLPEPRLMNIYIQQQIVKLGRRMNVRQQPLATAQIYVRRFYTKVEMRRTNPYLVMTTAVYVACKVEECPIHIRLVLAEAARQWPELGINDISKIGECEFHLISTMSARMIVHHPYRTLNDLAPGLSMSTEETALSQNIINDHYNTDMPLMYPPHIIAVTAMFLAVVLRPTQSNLQAHAAATSSPAIKSALDSPNKIARLTDWMAASQIDIPAVMAATQEFLSLYEVWENYGERACKEAISRFMKDAQLGK |
Length | 289 |
Position | Kinase |
Organism | Aureobasidium pullulans EXF-150 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.318 |
Instability index | 61.69 |
Isoelectric point | 7.09 |
Molecular weight | 33196.83 |
Publications | PubMed=24984952 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01082 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.04| 22| 22| 29| 50| 1 --------------------------------------------------------------------------- 29- 50 (40.21/21.62) QQENQELYNKYPLPEPRL..MNIY 52- 75 (32.83/16.65) QQQIVKLGRRMNVRQQPLatAQIY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.48| 16| 19| 82| 97| 2 --------------------------------------------------------------------------- 82- 97 (28.18/21.62) KVEMRRTNPYLVMTTA 103- 118 (27.30/20.74) KVEECPIHIRLVLAEA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELYNKY 2) IYVRRF | 34 74 | 39 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab