| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSVESLRSLEQVRQRLNTLANSIGKLLHDLDTNDPLPSWPSLQNSATLLSHNIASLHHTLINAQPLLANAHVYPLPAYPGRTQEDLLTQLLRKKLQPQVEDWIANGERHAAASTADPSQSNGADVDGPQPASQPLQAMTTAQLTDLWNWAGPEGNRVARDMGSDAFDDVFTLEEHELGIENVVTGLRRKLWDSDDEDEDDEEGEGGKKAEAKQEKMDVDMVDVVPDHVRRLQRHNLDPSKPPMSIEHILRFSLTAREPPNVVQ |
| Length | 263 |
| Position | Head |
| Organism | Aureobasidium pullulans EXF-150 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.671 |
| Instability index | 57.64 |
| Isoelectric point | 4.80 |
| Molecular weight | 29266.16 |
| Publications | PubMed=24984952 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP01074
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 175.39| 43| 92| 84| 126| 1
---------------------------------------------------------------------------
84- 126 (71.56/41.78) EDLLTQLLRKKLQPQVED.WIANG.ERHAAASTADPSQSNGADVD
132- 169 (40.98/21.13) ....SQPLQAMTTAQLTDlWNWAGpEGNRVAR..DMGSDAFDDV.
180- 219 (62.85/35.90) ENVVTGLRRKLWDSDDED...EDD.EEGEGGKKAEAKQEK.MDVD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GLRRKLW 2) HVRRLQRHNL 3) MSIEHILRFSLTAREPPN | 185 227 243 | 191 236 260 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab