<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01069
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTLRLDRSFLPSHGSLGGFPSAAVSSSAKALTAVFTHTNRPTSKQRRRQSPSFDHRPASTSTSIVASSPSPSHRPPPATSPIDSPVARMPTSPASPPYYYQNQPVIHKAAPVSVAPHTPPSPASVRMSSSAHNGKDQSFPTPPSSYVPTSSHSFAGMNTHNSTPQHSMDTDMPDAEAPQARPTLPLLCQSLCRIAHPISRPHPNENLINLYGLQSIANSVRRTDPITGEKINKLRKSYEGKVKNFGLTGKNKPTDLNEELRGLLQWDPESWYDQRVHGRELDKAESSPLMATLGRALTMNPGTLPADEHNKWKSILGLDDGNKTPSQPASKIPAHSQMLKAQASSMRASAPASPRASNPNGIRPDRSNKKRRYDESSYTGYNESYQEDDGYSTGGLDDKRNSATKKRRKV |
Length | 410 |
Position | Head |
Organism | Aureobasidium pullulans EXF-150 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.889 |
Instability index | 72.67 |
Isoelectric point | 9.88 |
Molecular weight | 44692.31 |
Publications | PubMed=24984952
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01069
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.89| 20| 20| 50| 69| 1
---------------------------------------------------------------------------
50- 69 (35.67/15.54) SPS..FDHRPASTSTSIVASSP
95- 116 (26.22/ 9.47) SPPyyYQNQPVIHKAAPVSVAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.40| 19| 20| 181| 200| 2
---------------------------------------------------------------------------
181- 200 (30.90/26.44) RPTLPLLCqSLCRIAHPISR
204- 222 (31.50/21.42) NENLINLY.GLQSIANSVRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.85| 18| 20| 118| 136| 3
---------------------------------------------------------------------------
118- 136 (28.63/18.81) TPPSpASVRMSSSAHNGKD
141- 158 (34.22/17.98) TPPS.SYVPTSSHSFAGMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.00| 16| 20| 315| 330| 4
---------------------------------------------------------------------------
315- 330 (27.78/16.06) ILGLDDGNKTPSQPAS
338- 353 (24.22/12.94) MLKAQASSMRASAPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.51| 30| 32| 238| 268| 5
---------------------------------------------------------------------------
238- 268 (48.91/32.69) YEGKVKNFGLtGKNKPTDLNEELRGLLQWDP
272- 301 (51.61/30.29) YDQRVHGREL.DKAESSPLMATLGRALTMNP
---------------------------------------------------------------------------
|