<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01066
| Description |
Meiotic mRNA stability protein kinase UME5 |
| Sequence | MSSMGYTSQRRINDNYDVVGFISSGTYGRVYKARNKSGRGAHPILSRNSGRPIEAFAIKKFKPDKEGELQYTGISQSAIREMALCTELSHENVISLVEIILESKCIFMVFEYAEHDLLQIIHWHTQHPRTPIPAPTLRSIMYQLLEGLLYLHRNWVLHRDLKPANIMVTSAGSVKIGDLGLARLFYKPLQALFGGDKVVVTIWYRAPELLLGSRHYTPAIDTWAVGCIFAELLSLRPIFKGEEAKQDSKKTVPFQRNQMGKIAEVLGIPRKESWPLLQAMPEYPQLQTLAAGNPAVQRPITLDKWWDNLTRNSQYAAANMPAPHRDGLAMLKSLLEYDPLHRLSAENALQHPYFLHDESNIPGAPPKNCFEGIEHKYPPRKVSSEDNDIRTGSLPGTKRSGLPDDSFLRPPKRVKEI |
| Length | 417 |
| Position | Kinase |
| Organism | Aureobasidium pullulans EXF-150 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.380 |
| Instability index | 48.30 |
| Isoelectric point | 9.19 |
| Molecular weight | 47155.73 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01066
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.75| 22| 221| 114| 135| 1
---------------------------------------------------------------------------
114- 135 (46.26/26.80) EHDLLQIIHWHT..QHP.....RTPIP.AP
336- 365 (27.49/13.33) EYDPLHRLSAENalQHPyflhdESNIPgAP
---------------------------------------------------------------------------
|