<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01059
Description |
C/H/G cyclin |
Sequence | MAANYWDSTQRTHWTFTKDQLDDIRTQQQQDNQELHSRFPLPEPRLMNIYIQQQIIKLGRRMNVRQQPLATAQVYVRRFYTRVDIRRTNPYLVMTTAVYVACKVEECPIHIRLVLAEAARQWPELGINDISKIGECEFHLISTMSARMIVHHPYRSLSDLAPGLNLSTEEMALSQNIINDHYNTDMPLMYPPHIIAVTAMFLAVVLRPTQSNLQAHAAATSALAVQSALQNPNKVAKMVQWMAESDIDVGECMAATQEFISLYEVWENYIERTCKDGITRFMKDALGK |
Length | 288 |
Position | Kinase |
Organism | Aureobasidium namibiae CBS 147.97 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.267 |
Instability index | 59.85 |
Isoelectric point | 6.50 |
Molecular weight | 33141.76 |
Publications | PubMed=24984952
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01059
No repeats found
|