Description | Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | MADQAQARMLSAAFPTPPPYYKHFTKQNVTKVRQIRKEAASNTNQIDVASLPAELRYLIPPEPPADGKYKSFGAQHDLAQPAQSLSQAGIQELYPTDVAHLDPTPHLQTLTRAVLLNFLELVGTLSVNPTQGPEKVEHLQTLFYNLHDLINRYRPHQARESLIMTMEDQLDKIRAQIKGVNSAKDRMQQVLGDI |
Length | 194 |
Position | Middle |
Organism | Aureobasidium namibiae CBS 147.97 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.498 |
Instability index | 27.52 |
Isoelectric point | 7.07 |
Molecular weight | 21802.59 |
Publications | PubMed=24984952 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP01058 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.29| 23| 31| 95| 122| 1 --------------------------------------------------------------------------- 74- 96 (37.43/16.68) AQHDLAQPAQSLSQA...GIQELYPT 99- 124 (36.86/28.50) AHLDPTPHLQTLTRAvllNFLELVGT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELRYLIP 2) PYYKHFTKQ | 54 19 | 60 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab