<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01058
| Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
| Sequence | MADQAQARMLSAAFPTPPPYYKHFTKQNVTKVRQIRKEAASNTNQIDVASLPAELRYLIPPEPPADGKYKSFGAQHDLAQPAQSLSQAGIQELYPTDVAHLDPTPHLQTLTRAVLLNFLELVGTLSVNPTQGPEKVEHLQTLFYNLHDLINRYRPHQARESLIMTMEDQLDKIRAQIKGVNSAKDRMQQVLGDI |
| Length | 194 |
| Position | Middle |
| Organism | Aureobasidium namibiae CBS 147.97 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.498 |
| Instability index | 27.52 |
| Isoelectric point | 7.07 |
| Molecular weight | 21802.59 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP01058
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.29| 23| 31| 95| 122| 1
---------------------------------------------------------------------------
74- 96 (37.43/16.68) AQHDLAQPAQSLSQA...GIQELYPT
99- 124 (36.86/28.50) AHLDPTPHLQTLTRAvllNFLELVGT
---------------------------------------------------------------------------
|