<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01051
| Description |
Uncharacterized protein |
| Sequence | MADRLTQLQDCLDDLATQMFASIRYIQTRHQFASIPDQPDMSEPTAPNAPAPLQPNAAPNTLTASAAEQGGLNAALQPQDPTHPPGPDDPATFQAALRELARDLVLKEQQIEYLISVLPGIGESEANQSQRIQALERELREADEERKVALAEREAMLDKLGRLAAECKRVY |
| Length | 171 |
| Position | Middle |
| Organism | Aureobasidium melanogenum CBS 110374 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.546 |
| Instability index | 52.04 |
| Isoelectric point | 4.59 |
| Molecular weight | 18796.87 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01051
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.02| 20| 20| 36| 55| 1
---------------------------------------------------------------------------
36- 55 (38.96/16.07) PDQPDMSEPTAPNAPAPLQP
59- 78 (31.06/11.68) PNTLTASAAEQGGLNAALQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.28| 14| 20| 135| 148| 2
---------------------------------------------------------------------------
135- 148 (22.12/12.46) LERELREADEERKV
157- 170 (23.16/13.31) LDKLGRLAAECKRV
---------------------------------------------------------------------------
|