<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01047
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSSSAHNGKDQSFPTPPSSYVPTNSLSNRDLNSHKSTPPHANSDMDTDMPDAQAQPPSLPSRPVLPLLCQSPHPISRPHPNENLINLYGLQSIANSVRRTDPITGEKINKLRKSYEGKVKNFGLSGKNKPTDVPGELAGFMQWDEGSWYDQRIHGRELENAQSSSLMANLGRALTMNPGTLPADEHNKWKAILGLDDGNKTPSQPANKIAAHPQMLKAQASSMRASAPASPRSSNPNGIRPDRSNKKRRYDESSYSGYNESYQEDDGYSTGGLDDKRNSAAKKRRKDYPTNFETSGGSPAFNNGMLGVGVKSS |
| Length | 313 |
| Position | Head |
| Organism | Aureobasidium namibiae CBS 147.97 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.029 |
| Instability index | 58.57 |
| Isoelectric point | 9.31 |
| Molecular weight | 34116.29 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01047
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.84| 28| 33| 243| 273| 1
---------------------------------------------------------------------------
243- 273 (46.81/32.21) RSN..KKRRYDessYSGYNESYQEDDGYSTGGL
277- 306 (47.04/25.41) RNSaaKKRRKD...YPTNFETSGGSPAFNNGML
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.51| 16| 17| 24| 39| 2
---------------------------------------------------------------------------
15- 36 (23.08/10.75) TPPssyvptNSLSNRDLNSHKS
37- 54 (26.43/13.35) TPP....haNSDMDTDMPDAQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.47| 18| 20| 172| 191| 3
---------------------------------------------------------------------------
174- 191 (34.35/21.92) LTMNPGT.LPADEHNKWKA
193- 211 (27.12/10.10) LGLDDGNkTPSQPANKIAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.82| 15| 32| 88| 106| 5
---------------------------------------------------------------------------
88- 106 (14.35/22.19) YGLqSIANsvRRTDpITGE
122- 136 (29.47/17.25) FGL.SGKN..KPTD.VPGE
---------------------------------------------------------------------------
|