<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01040
Description |
"Serine/threonine protein kinase, CMGC family, CDC2/CDK subfamily" |
Sequence | MSSMGYTSQRRINDNYDVVGFISSGTYGRVYKARNKSGRGHHPVLSRNSGNPIEAFAIKKFKPDKEGELQYTGISQSAIREMALCTELSHENVISLVEIILESKCIFMVFEYAEHDLLQIIHWHTQHPRTPIPAPTLRSIMYQLLEGLLYLHRNWVMHRDLKPANIMVTSAGVVKIGDLGLARLFYKPLQALFGGDKVVVTIWYRAPELLLGSRHYTPAIDTWAVGCIFAELLSLRPIFKGEEAKQDSKKTVPFQRNQMGKIAEVLGIPRKESWPLLQAMPEYPQLQTLAAGNPAVQRPIGLDKWWDNLTRNSQYSAANMPAPHRDGLDMLKALLEYDPLKRLSAEHALQHPYFLHDESNLPAAPPKNCFAGVEHKYPPRKVSSEDNDIRTGSLPGTKRSGLPDDSFLRPPKRVKEI |
Length | 417 |
Position | Kinase |
Organism | Aureobasidium melanogenum CBS 110374 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.380 |
Instability index | 48.46 |
Isoelectric point | 9.18 |
Molecular weight | 47151.76 |
Publications | PubMed=24984952
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01040
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.71| 21| 39| 319| 354| 1
---------------------------------------------------------------------------
319- 341 (35.13/36.93) NMP.APHRDGLDMLKAllEYDPLK
360- 381 (37.58/11.58) NLPaAPPKNCFAGVEH..KYPPRK
---------------------------------------------------------------------------
|