<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01037
| Description |
Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
| Sequence | PLDEVQFRRPDVIAYWEGIHENSIHPILRETPFFDPTTKNGLLWKQAEIHPPIWDMCRNRQAFETRLKQMNGVEYLIVGEPQPNPDPSLGPDTGIWVIRKQDRRKRPTQPDEITVLATYYLVGENMYQAPSVYDIVGNHLLSAMTSLTKFTQTAAPLPLYTPATGYTYFPPATAKSLVASQALSSTSREASTAPTPAELPSAAALDPAAQSTTSNELKSTKGADPRAQRALQDSLQMMLHYGDEYMDENPLRGEPGNFTFSAT |
| Length | 263 |
| Position | Head |
| Organism | Aureobasidium melanogenum CBS 110374 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.524 |
| Instability index | 43.20 |
| Isoelectric point | 5.28 |
| Molecular weight | 29280.60 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01037
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.29| 34| 41| 54| 94| 1
---------------------------------------------------------------------------
54- 88 (59.78/43.02) WDMCR.NRQAFETRLKQMNGV.EYLIVGEPQPNPdPS
96- 131 (52.51/22.79) WVIRKqDRRKRPTQPDEITVLaTYYLVGENMYQA.PS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.35| 14| 33| 171| 186| 2
---------------------------------------------------------------------------
171- 186 (14.03/18.57) PAtAKSlVASQALSST
207- 220 (23.32/15.34) PA.AQS.TTSNELKST
---------------------------------------------------------------------------
|