Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MADSNYGGYTRFELELEFVQCLSNPLYLNHLATQKLLDDPEFIAYLSYLQYFAEPKYIKYLSYPGPTIRALELLQQERFRKDILIPETVARMAEEGLQASTDGLRRD |
Length | 107 |
Position | Middle |
Organism | Aureobasidium melanogenum CBS 110374 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.359 |
Instability index | 40.50 |
Isoelectric point | 4.84 |
Molecular weight | 12489.06 |
Publications | PubMed=24984952 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01036 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.28| 16| 20| 27| 46| 1 --------------------------------------------------------------------------- 27- 45 (22.50/21.82) YLNHLATQKLLddpEFIAY 48- 63 (28.78/12.90) YLQYFAEPKYI...KYLSY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.28| 12| 21| 64| 75| 2 --------------------------------------------------------------------------- 64- 75 (21.70/13.69) PGPTIR.ALELLQ 86- 98 (16.58/ 9.22) PETVARmAEEGLQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FRKDILIPETVARMAEEGLQASTDGLR 2) KYLSYP | 79 59 | 105 64 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab