<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01033

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDNLDDLFGEEGINAAIAATFDTDALSQRIERSHIVGCCQRLAWSRTSCIAQISADSRKVLVRALCRDKNTAKWSLSDATEVNASDGAIFTHVEWSSSGLDLVIADQFGRLTLFSLTHALNSLERRPVNLTSNVDDLNQIVGLHWLPLNLAGQTRTALINPAAKEGNRWSNTMRLHDIHGVSNPIDNKAAFLCITRRCQLKLIYEQPGQPWSQAGSTLDSLTDSGDALTHAAFCQANQHLVMVTYDASKHLRLYKIMINWQANAGDGNTHKASLNPQMAILHVELLDQCVPQSSERAASAQLSSLHIEPISQAIDNSTFTVVAVFTSAAQDHGGKFSVISRWDLQQTEATLHESFKGLKPTASQPNNSKSIQRLHRMEDVISPKAILAFQSNVYHNTFAFAASDGTIEFRSRETMQVIEPDHDANKATSLPQNGFNFLTSECVDISLSPSMASSVITKPDGTVNLHSAEYIHGWKDVKEDNDLAQAAVVSLARELGIVTCYQIGFDDLLSVIPTDLDRSLRRKFISEIFRTINRNTDFSLDDPKLQSGRVLKDSLLYRIASAQLIVSYQTDPKRRDIPAKAAWVLLNLRSVCTNIAQTLSMTQTIRGMQNLESSLFVSLKGLVRWSLDLMTLIFDDMIEMMRFCKSDFDRQKILTYVHEKNTATLHLLLSSTSRALLGMLGNLIRNFAMRVVKTQEKVRHSSRANDIRDSVELQHMEAMMGAELPFEIRLFEQLVAETDGNVRATYQAAQSSPPQRSFYEQSMLVDADIPEALSPVLQKLFGDIVPRLEKQIDGVAIYTAETAWLGLGEDEEANKRAGRQQYDVLRKCAIPPNAKVRQCRRCGSVIENLVDGHMAAWVQNAHKMCICLSHWIVA
Length874
PositionTail
OrganismAureobasidium melanogenum CBS 110374
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
Aromaticity0.07
Grand average of hydropathy-0.201
Instability index43.49
Isoelectric point6.24
Molecular weight97378.66
Publications
PubMed=24984952

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01033
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.74|      30|      36|     395|     425|       1
---------------------------------------------------------------------------
  395-  425 (49.22/36.88)	HNTFAFAASDgTIEFRSRETM..QVI.EPDHDAN
  432-  464 (44.52/28.00)	QNGFNFLTSE.CVDISLSPSMasSVItKPDGTVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     136.85|      36|      41|     132|     171|       2
---------------------------------------------------------------------------
   95-  128 (20.34/ 6.20)	.........WsssgLD.......LVIADQfGRLTLfsLTHALNSLERRPV
  136-  171 (63.62/42.08)	DLNQIVGLHW....LP.......LNLAGQ.TRTAL..INPAAKEGNRWSN
  174-  213 (52.89/25.91)	RLHDIHGVS.....NPidnkaafLCITRR.CQLKL..IY..EQPGQPWSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.21|      10|      37|     223|     232|       4
---------------------------------------------------------------------------
  223-  232 (18.05/ 9.42)	DSGDALTHAA
  263-  272 (19.16/10.40)	NAGDGNTHKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      98.61|      30|      42|     675|     704|       7
---------------------------------------------------------------------------
  675-  704 (50.85/36.49)	ALLGM.LGNLIRNFAMRVVKTQEKVRHSSRA
  718-  748 (47.77/33.84)	AMMGAeLPFEIRLFEQLVAETDGNVRATYQA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01033 with Med16 domain of Kingdom Fungi
Unable to open file!