Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADQAQARMLSAAFPTPPPYYKHFTKQNVTKVRQIRKEAATNTNQVDVESLPAELRYLIPPEPPADGRYKSFGAQHDLAQPAQSLAQAGIQELYPADAAHLDPTPHLQTLTRAVLLNFLELVGTLSVNPTQGPEKVEHLQTLFYNLHDLINRYRPHQARESLIMTMEDQLDKIKTQIKGVNAAKDRMQQVLGDIRSNAISDSIETPTKQEKPAEAEAFRTTDSIHKAMYEAMEHDLDD |
Length | 238 |
Position | Middle |
Organism | Aureobasidium melanogenum CBS 110374 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.621 |
Instability index | 32.00 |
Isoelectric point | 5.72 |
Molecular weight | 26762.88 |
Publications | PubMed=24984952 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01031 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.98| 15| 23| 74| 88| 1 --------------------------------------------------------------------------- 74- 88 (25.84/12.72) AQH.DLAQPAQSLAQA 98- 113 (23.14/10.77) AAHlDPTPHLQTLTRA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 60.55| 14| 27| 171| 184| 2 --------------------------------------------------------------------------- 171- 184 (21.50/11.36) DKIKTQIKGVNAAK 188- 200 (17.70/ 8.48) QQVLGDIRS.NAIS 201- 214 (21.35/11.24) DSIETPTKQEKPAE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.10| 16| 25| 117| 134| 5 --------------------------------------------------------------------------- 117- 134 (23.53/20.56) NFLELVGtlSVNPTQGPE 145- 160 (29.56/18.88) NLHDLIN..RYRPHQARE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AELRYLIP 2) PYYKHFTKQ | 53 19 | 60 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab