<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01031
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQAQARMLSAAFPTPPPYYKHFTKQNVTKVRQIRKEAATNTNQVDVESLPAELRYLIPPEPPADGRYKSFGAQHDLAQPAQSLAQAGIQELYPADAAHLDPTPHLQTLTRAVLLNFLELVGTLSVNPTQGPEKVEHLQTLFYNLHDLINRYRPHQARESLIMTMEDQLDKIKTQIKGVNAAKDRMQQVLGDIRSNAISDSIETPTKQEKPAEAEAFRTTDSIHKAMYEAMEHDLDD |
| Length | 238 |
| Position | Middle |
| Organism | Aureobasidium melanogenum CBS 110374 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.621 |
| Instability index | 32.00 |
| Isoelectric point | 5.72 |
| Molecular weight | 26762.88 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01031
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.98| 15| 23| 74| 88| 1
---------------------------------------------------------------------------
74- 88 (25.84/12.72) AQH.DLAQPAQSLAQA
98- 113 (23.14/10.77) AAHlDPTPHLQTLTRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.55| 14| 27| 171| 184| 2
---------------------------------------------------------------------------
171- 184 (21.50/11.36) DKIKTQIKGVNAAK
188- 200 (17.70/ 8.48) QQVLGDIRS.NAIS
201- 214 (21.35/11.24) DSIETPTKQEKPAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.10| 16| 25| 117| 134| 5
---------------------------------------------------------------------------
117- 134 (23.53/20.56) NFLELVGtlSVNPTQGPE
145- 160 (29.56/18.88) NLHDLIN..RYRPHQARE
---------------------------------------------------------------------------
|