Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNTLPDMDTDMPDVQAPSSRPALPLLCQSPHPISRPHPNEDLINLYGLQSIANSVRRTDPVTGEKINKLRKSYEGKVKNFGLSGKNKPTDIPGELGGFMQWDEGSWYDQRIHGRELDKAESSSLMANLGRALTMNPGTLPAEEHNKWKAILGLDDGNKTPSQPANKMAAHPQMLKAQASSMRASAPASPRASHPNSIRPDRSNKKRRYDESSYTGYNESYQEDDGYSTGGLDDKRNSATKKRRKDFPTNFEASGGSSSFNNGMLGVGVKSS |
Length | 271 |
Position | Head |
Organism | Aureobasidium melanogenum CBS 110374 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.987 |
Instability index | 55.84 |
Isoelectric point | 9.14 |
Molecular weight | 29735.73 |
Publications | PubMed=24984952 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01030 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 116.72| 35| 68| 154| 188| 1 --------------------------------------------------------------------------- 154- 188 (59.52/27.73) DDGNKTPSQPANKMAAHPQMLKAQASSMRASAPAS 223- 257 (57.21/26.43) DDGYSTGGLDDKRNSATKKRRKDFPTNFEASGGSS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.57| 30| 32| 74| 104| 2 --------------------------------------------------------------------------- 74- 104 (49.20/36.83) EGKVKNFGLsGKNKPTDIPGELGGFMQWDEG 108- 137 (49.37/32.14) DQRIHGREL.DKAESSSLMANLGRALTMNPG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.38| 20| 33| 5| 24| 4 --------------------------------------------------------------------------- 5- 24 (38.38/24.88) PDMD.TDMPDVQ..APSSRPALP 38- 60 (27.00/15.50) PNEDlINLYGLQsiANSVRRTDP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKRRKDFPTNF 2) WKAILGL | 240 147 | 250 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab