<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01029
| Description |
Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | MLSVFQTRFQRLETALNSLVESVAAYNPSISAADALVAADEDLDESLEQLAVHHANYSRILELRATADALDEKIKYTLRTLADTRKELLDIPSSQPPPNTRQVGVEELLSYAKFISKTTVPPTFRGHISTELLSQPQPAIPDGPTTQITNGMATPAQNGDSTNTADQSAQPENRAVATLSAETKAMLDPLSQLPFVPWPSQEVIRMGALAAIQGMLEDGTDPTTVLSAEEQEAADK |
| Length | 236 |
| Position | Middle |
| Organism | Aureobasidium melanogenum CBS 110374 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.317 |
| Instability index | 39.04 |
| Isoelectric point | 4.47 |
| Molecular weight | 25483.19 |
| Publications | PubMed=24984952
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01029
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.68| 31| 95| 66| 97| 1
---------------------------------------------------------------------------
66- 97 (47.25/29.21) TADALDEKIKYTLRTLADTRKELLDiPSSQPP
164- 194 (48.42/26.19) TADQSAQPENRAVATLSAETKAMLD.PLSQLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.41| 9| 14| 138| 147| 3
---------------------------------------------------------------------------
138- 147 (14.12/10.79) PAiPDGPTTQ
155- 163 (17.29/ 8.44) PA.QNGDSTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.58| 15| 29| 12| 26| 4
---------------------------------------------------------------------------
12- 26 (22.96/14.43) LETALNSLVESVAAY
43- 57 (25.62/16.78) LDESLEQLAVHHANY
---------------------------------------------------------------------------
|