<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01029

Description Mediator of RNA polymerase II transcription subunit 4 (Fragment)
SequenceMLSVFQTRFQRLETALNSLVESVAAYNPSISAADALVAADEDLDESLEQLAVHHANYSRILELRATADALDEKIKYTLRTLADTRKELLDIPSSQPPPNTRQVGVEELLSYAKFISKTTVPPTFRGHISTELLSQPQPAIPDGPTTQITNGMATPAQNGDSTNTADQSAQPENRAVATLSAETKAMLDPLSQLPFVPWPSQEVIRMGALAAIQGMLEDGTDPTTVLSAEEQEAADK
Length236
PositionMiddle
OrganismAureobasidium melanogenum CBS 110374
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Dothideales> Saccotheciaceae> Aureobasidium.
Aromaticity0.04
Grand average of hydropathy-0.317
Instability index39.04
Isoelectric point4.47
Molecular weight25483.19
Publications
PubMed=24984952

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01029
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.68|      31|      95|      66|      97|       1
---------------------------------------------------------------------------
   66-   97 (47.25/29.21)	TADALDEKIKYTLRTLADTRKELLDiPSSQPP
  164-  194 (48.42/26.19)	TADQSAQPENRAVATLSAETKAMLD.PLSQLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.41|       9|      14|     138|     147|       3
---------------------------------------------------------------------------
  138-  147 (14.12/10.79)	PAiPDGPTTQ
  155-  163 (17.29/ 8.44)	PA.QNGDSTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.58|      15|      29|      12|      26|       4
---------------------------------------------------------------------------
   12-   26 (22.96/14.43)	LETALNSLVESVAAY
   43-   57 (25.62/16.78)	LDESLEQLAVHHANY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01029 with Med4 domain of Kingdom Fungi

Unable to open file!