| Description | Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIVSQLQEQVNLIAHLASNTVGTLQRDAPSSQLSPNYPEPPAHTTSMDSANFSEQPKLMASTLMKAAKQAPFPVGDENRSPTVGDIKKW |
| Length | 90 |
| Position | Middle |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.532 |
| Instability index | 64.82 |
| Isoelectric point | 5.49 |
| Molecular weight | 9762.87 |
| Publications | PubMed=22089132 PubMed=24767513 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats | >MDP01025 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DIVSQLQEQVNLIAHLASNTVGTLQ 2) QLSPNYPEPPAHTTSMDSANFSEQPKLMASTLMKAAKQAPFPVGDENRSPTVGDIKKW | 2 33 | 26 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab