<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01024
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDRALSPASVRPKSIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPTNKELTHRQQFYFWKNYRNNRLKHILPRSLAEPSAALPAPASTQPQPPVPALPPVPATSVAVTTSSSQAPSPMPYGIPPGSGIAKNDMRNTSADRRKRK |
| Length | 198 |
| Position | Middle |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.616 |
| Instability index | 61.56 |
| Isoelectric point | 9.67 |
| Molecular weight | 22858.90 |
| Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01024
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.42| 20| 27| 26| 45| 1
---------------------------------------------------------------------------
26- 45 (37.02/20.13) FLLELEFVQCLANPTYIHYL
56- 75 (36.39/19.69) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.49| 13| 26| 81| 93| 2
---------------------------------------------------------------------------
81- 93 (21.95/11.36) LYFLELLQNANFR
110- 122 (25.54/14.07) FYFWKNYRNNRLK
---------------------------------------------------------------------------
|