<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01022

Description Mediator of RNA polymerase II transcription subunit 25
SequenceMAEKKVIVVVESTAAMGPHWDTLQVDYLNKIVKSLCGNEPAVSNAQFALVTYHTHGIYSPVLVQRSGWTRDPEVFLDWLSSISFSGGGLNDTAVAEGLAEALMMFSPSQSESPNQKNVDMPMHCILVAASNPYPLKRPIYVPKKNESIDSESGNQFYDAEDVAKAFPQFSISLSVICPRNLPKIKAIYNAGAVNPPVDAKPPLVLISEGFREARTALSPSGTTNLPSNQIHVKVDDVSVAPVTGAPPSSLPSVNGSIANRQPIPNVSVTPATVKAEPVPVKVEPLPVKVERVVKIERGTTSSGPPVITSSGYLTASTQVGQQSSLDLLMSATSQPSANIQGAVSMGQQVPRMIPTPGMPQQVQSGMQPLVNNAAATNMPLSQQTTSAQPPKYIKAWEGTLTGLRQGQPVFISKLEGYRSFSASETLTADWPAGMQIGRLISQDHMNNKQYIGKADFLVFRAMNQHGFLGQLKEKKQCAVIQLPSQTLLMSVSDKPCRLIGMIFPKEMVVTKPPLSSQQQLQQQQMQQQHQQMQSQQQQQLSHMQQQQQLSQHQQLPQQQQMVGAGRGQNYVQDPGRSQTVSQGQVSSQGATNSGRGNFMS
Length600
PositionUnknown
OrganismMedicago truncatula (Barrel medic) (Medicago tribuloides)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
Aromaticity0.05
Grand average of hydropathy-0.342
Instability index51.87
Isoelectric point8.99
Molecular weight65010.29
Publications
PubMed=22089132
PubMed=24767513
PubMed=30397259

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central

GO - Biological Function
DNA binding	GO:0003677	IEA:EnsemblPlants

GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
jasmonic acid mediated signaling pathway	GO:0009867	IEA:EnsemblPlants
positive regulation of defense response	GO:0031349	IEA:EnsemblPlants
positive regulation of flower development	GO:0009911	IEA:EnsemblPlants
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central
red, far-red light phototransduction	GO:0009585	IEA:EnsemblPlants
response to far red light	GO:0010218	IEA:EnsemblPlants
response to red light	GO:0010114	IEA:EnsemblPlants
trichome branching	GO:0010091	IEA:EnsemblPlants
trichome papilla formation	GO:1905499	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01022
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.56|      18|      28|     514|     539|       1
---------------------------------------------------------------------------
  514-  532 (30.44/ 9.91)	LSSQQQL.QQQQMQQQhQQM
  543-  561 (31.12/13.75)	MQQQQQLsQHQQLPQQ.QQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.55|      27|      28|     225|     251|       3
---------------------------------------------------------------------------
  225-  251 (48.13/20.54)	LPSNQIHV.KVDDVSVAPVT.GAPP...SSLP
  257-  279 (29.30/10.11)	IANRQ....PIPNVSVTPATvKAEP....V.P
  285-  312 (26.12/ 8.34)	LP...VKVeRVVKIERGTTS.SGPPvitSSGY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.46|      29|      38|     127|     160|       4
---------------------------------------------------------------------------
  110-  149 (44.84/25.12)	SESPNQknvdmpmhcilVAASNP.YPLKRPIYVPKKNESID
  150-  185 (38.61/29.00)	SESGNQ.....fydaedVAKAFPqFSISLSVICPRNLPKIK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.23|      18|      19|     350|     368|       5
---------------------------------------------------------------------------
  350-  368 (31.49/17.80)	PRMIPT.PGMP..QQVQSGmQP
  370-  389 (23.92/ 8.72)	VNNAAA.TNMPlsQQTTSA.QP
  390-  408 (23.82/ 8.65)	PKYIKAwEGTL..TGLRQG.QP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01022 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PPLSSQQQLQQQQMQQQHQQMQSQQQQQLSHMQQQQQLSQHQQLPQQQQMVGAGRGQNYVQDPGRSQTVSQGQVSSQGATNSGRGNFMS
2) SANIQGAVSMGQQVPRMIPTPGMPQQVQSGMQPLVNNAAATNMPLSQQTTSAQ
512
336
600
388










Molecular Recognition Features






MoRF SequenceStartStop




NANANA