<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00998

Description "Mediator of RNA polymerase II transcription subunit 8, putative"
SequenceMEGELVQQPQPQQQERLNQAVQQQLNLEQVKTRAISLFKAISRILEDFDAYGRTNTNPKWQDILGQYSMVNLELFNIVDDIKKVSKAFIVYPKNVNAENATILPVMLSTKLLPEMETEDTLKRDQLLQGMQNLPIATQIDKLKARIDMIAAACEGAEKVLADTRKAYCFGTRQGPAIAPTLDKGQAAKIQEQENLLRAAVNVGEGLRIPGDQRHITASLPMHLADAFTVNESAQSFPDGSSNNVYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPSAATSATSFDNTTASPIPYANSPRSTTNMMNTPSPQQQTPQPQPQQLTAQQQQQQRQKLMQQLPQQQQQQLLAQQQYRQSAMQQGLGQLHGQHQMQFSPQLGHQQFQGRQLSSAHMQHSIGQSQLNQGNQMTRLNQFSGPANSALFSAAQTTPNTQMV
Length436
PositionHead
OrganismMedicago truncatula (Barrel medic) (Medicago tribuloides)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
Aromaticity0.05
Grand average of hydropathy-0.638
Instability index48.95
Isoelectric point8.76
Molecular weight48118.58
Publications
PubMed=22089132
PubMed=24767513

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00998
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      61.44|      12|      17|     343|     354|       2
---------------------------------------------------------------------------
  343-  354 (21.34/ 8.30)	QQQQQQLLAQQQ
  361-  372 (21.54/ 8.45)	QQGLGQLHGQHQ
  391-  402 (18.57/ 6.24)	SAHMQHSIGQSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.64|      14|      15|     276|     289|       4
---------------------------------------------------------------------------
  276-  289 (24.53/11.99)	ASP.SAATSATSFDN
  292-  306 (22.11/10.13)	ASPiPYANSPRSTTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.70|      23|      37|      41|      64|       5
---------------------------------------------------------------------------
   41-   64 (37.30/33.22)	ISRILEDFDAYGRtNTNPKWQDIL
   81-  103 (37.40/27.68)	IKKVSKAFIVYPK.NVNAENATIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.81|      10|     308|       5|      14|       6
---------------------------------------------------------------------------
    5-   14 (20.67/ 7.51)	LVQQPQPQQQ
  307-  316 (21.15/ 7.85)	MMNTPSPQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.48|      22|      46|     144|     165|       8
---------------------------------------------------------------------------
  144-  165 (36.42/30.00)	ARI....DMIAAACEGAE..KVLADTRK
  187-  214 (27.06/20.47)	AKIqeqeNLLRAAVNVGEglRIPGDQRH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00998 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AFTVNESAQSFPDGSSNNVYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPSAATSATSFDNTTASPIPYANSPRSTTNMMNTPSPQQQTPQPQPQQLTAQQQQQQRQKLMQQLPQQQQQQLLAQQQYRQSAMQQGLGQLHGQHQMQFSPQLGHQQFQGRQLSSAHMQHSIGQSQLNQGNQMTRLNQFSGPANSALFSAAQTTPNTQMV
226
436










Molecular Recognition Features






MoRF SequenceStartStop




NANANA